SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI219092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI219092
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-32
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI219092
Sequence length 115
Comment (Branchiostoma floridae)
Sequence
LVKRERGGSKRNALLKWCQRKTQGYTGIDVTNFSTSWNDGLSFCALLHSYLPEKVPFSEL
TAQNKRKNFTTAFQAGESVGIPTMLSADELVQTERPDWQAIMAYVTAIYAKFENV
Download sequence
Identical sequences C3Z445
XP_002596646.1.56174 7739.JGI219092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]