SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI67578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI67578
Domain Number 1 Region: 28-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.76e-25
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI67578
Sequence length 581
Comment (Branchiostoma floridae)
Sequence
MQSGRRGALEGTNVLYWPYDGGYNPSTDREKTQHEIQEYTVWANAYLAERGDLPPVGDLV
TALSDGITLIKLVEVMAEQQVPYPHPKPTSWIQRVENTTACLSFCGEGGVMLEGLTSSDI
VDGKAKAILALCHALRIRCEVPLTSRHKPYHHSGARYDGIDNQGHAQVPLVTWEQEDMAI
FAWVKCMLGHMVVDYSVLVNKICEGDIEPTVWMDKSHADRLYVAMETVERKFGLPCFLDV
QTVTRGQGHESLRDYLSQLKKLGDMHIQQKKWREEKEAEARRERERWERVHLKRREAQEH
RRKLEDMFDRHRQQLEELDTAVKRKEMELAKQMNVSYNEYKRLKSPRPKPAEIDEGKNQE
VGAVRPNTTTSIGQGTKTDSKASKDTASNSTSVPKPKSAIHNVTDTPEKSVVDEPDKESE
DRDHSEVTSSTSGDDIGKSDVTDSMWNETLKSLSKLALRREQKSVLVTKPSNLPGVATDR
EQHRLEGQDGDGQNVGSGPSKQIGRESGSHLSAHRESGNERPVSSSLTSVSPASNTDVKG
SGLAGSANTGNLPTGYFKNAARRALFFASLSPEPDDQLSDG
Download sequence
Identical sequences C3YBI8
7739.JGI67578 XP_002606335.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]