SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI84417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI84417
Domain Number 1 Region: 79-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 40-81
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000049
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI84417
Sequence length 269
Comment (Branchiostoma floridae)
Sequence
MSTAVSLLLVAFTVLQCLVWDVAATCFSYPQNLCCKGKNNECKTSGRRLDGTVGACFCDE
NCYVMRDCCSDYENACQAVACQVSEWGSWSGCSVSCGEGVSERRRYVLTSPRGGGPACPP
LVQKRACYNYGYWCSSATKEVAHILPASFGHLRLSDEPKGAMGLIMDSRKSHMYCVNFRV
TSTSAACRLRSNYLAGWTRTLRPGANVCVECQPHAMDRKMHCRGDGASGPNTGRWTAVDA
TGCRGTWKKHSRQENCYCSGYRGYGFIFV
Download sequence
Identical sequences C3YDL2
XP_002605813.1.56174 7739.JGI84417 7739.JGI84426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]