SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI94550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI94550
Domain Number 1 Region: 17-36,124-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000622
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 241-289
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000785
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI94550
Sequence length 786
Comment (Branchiostoma floridae)
Sequence
MENTEVDKDSRLKEYFVAAVRTGNEIVLEELLSNGVSGARRTRPAMDAIKHLKQAMFRRS
GILISNMRQFSVQKHAYLESQDVPLEHRPCMSDCIDVLMRHETRAYADKSNRVSGIRFYR
HTRDMDGVNCWKTPMIFAAENGHHETICRLKKHSINIDGTNTYNHLSSCIRFGAVDAIFV
LCQHGARCYSKPTDKFTPEGPLHHAIKTGNIRIVELMLRTLGTVDCRPMITDQTDEQVAE
LLRKVSSAPRTLSHLCRHVIRRLLGEKRCYFGVELLPLPNRLKCFVKLVERHVVILSTAA
ISGMYLATLLYIFPKVVKDDESSPLPRREGQAGHISGKRKVYLKDDTTGQPSPKPVKRPE
SAGNAAQTSSPLRVFVYDLPSEFNSGLVHCIQVKNRCYQLQDYGMGLEFARYGNVSFRST
HMFSLEVILHQKLLSSTFRTLDPEKADVFYIPYYPALAAACEPVSTIDSPALDRELWQFI
TSNYPYFQQGKPHMMALGRIEREHADVTGGILKTRESRSVTFVAIEHESDPKTLKFIRRS
GLPMVVAPYPSCGHLLSDNKFGGESKSERTQLDIPRDVLVLFAGSRRMSHDIRRILSQQL
RPTSEKYDATSSLNKQNVWFITQECRDRSWQENLVEWMHHSVFCLQPPGDSPTRKSFFDA
VQCGCIPVIFKLDHEPVYPFDDVLDYSKFTVKVTDGDFFQEKRSIVDILQDIPEAVIAAK
RAELRQVTPLLQYSYPPLPETHVQDAFDMIMQEIGRTRGGRSNVRRRYGSKVRKVVGRGA
GGWVVQ
Download sequence
Identical sequences C3YPA1
XP_002601673.1.56174 7739.JGI94550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]