SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000004667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000004667
Domain Number 1 Region: 217-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000206
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000716
Further Details:      
 
Domain Number 2 Region: 286-391
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000144
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000004667
Domain Number - Region: 55-117
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0722
Family MBT repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000004667
Sequence length 676
Comment (Danio rerio)
Sequence
MDGLAVEVRGSNGAFYKGFIKDVHEDSLTIVFENNWQPERQLPFSDVRLPPPTDYHKDIC
EGDEVEVYSRANEQEPCGWWLARVRMMKGEFYVIEYAACDATYNEIVTSERIRPVNPNSP
SAQNSFYKVPIAVPEDLRDICLTENIHKDFRKAIGANCIFYNTSTHQLIVLSTNESTVKR
AGLLSDMHFRSIRTKLMLMSRNEEATKHLETSKQLASAYQEEVKVREDLMGLAIGSHGAN
IQQARKVPGVTAIELEEESCTFRIYGETPEAVKQARTYLEFKEDSFPVPRNLVGKVIGKN
GKIIQEIVDKSGVVRVRIEGDNDKKLPREEGGRQGAGRDNIVSSQEGTVPFIFVGTKENI
SNAQALLEYHVAYLQEVEQLRLERLQIDEQLRQIGVGYRAPPSRSGSGVAGERERGYLTD
ESTNSLQTTRTYGGRGRGRKPNNTYSGYGTNSEMSNASETEDLGDRESRPKGVGADDRGS
KRGGRGRGSSAGRGRGGPGLRNINTISSVLRDPDSNPYSLLEGEGEQGGDTDASESMGGI
DRRRRSRRRRNDLEPSLMDAAANESDGQGATSENGLEEEGRPQRRNRSRRRRNRANRPEG
GSTSRDRQPVTVADFISRAESQSRQNLPGKEANPHVSHPKENGTSVSKEERTPSKRSPSN
GVASPGEALAMVNGVS
Download sequence
Identical sequences F1RC77
ENSDARP00000004667 7955.ENSDARP00000004667 ENSDARP00000004667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]