SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000004918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000004918
Domain Number 1 Region: 104-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-82
Family Nuclear receptor ligand-binding domain 0.00000000137
Further Details:      
 
Domain Number 2 Region: 50-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.49e-27
Family Nuclear receptor 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000004918
Sequence length 379
Comment (Danio rerio)
Sequence
MPVPEQKQTVQLSSPMNAVSSSEDIKPPLGLNGVMKVPAQPIGTLSLSLTKHICAICGDR
SSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCMIDKRQRNRCQYCRYQKCLAMGMK
REAVQEERQRAKERSEAEFGGCANEDMPVEKILEAELAVEPKTETYVEANLSPSANSPND
PVTNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHTAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPSEVEALRERVYASLEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQIT
Download sequence
Identical sequences F1RDN3
7955.ENSDARP00000004918 ENSDARP00000004918 ENSDARP00000004918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]