SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000005097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000005097
Domain Number 1 Region: 350-445
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.3e-23
Family Tudor domain 0.0001
Further Details:      
 
Domain Number 2 Region: 152-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 3 Region: 76-150
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000005097
Sequence length 573
Comment (Danio rerio)
Sequence
MDVAVPKSRVFLNYSPTALFSQWSLPVTPTQVMAAVQDGPWKSLSSGKKVALAAGISVGA
TVGYLIYRHIRNSTEQCQSKEESRISVPLDVYRSIARYQSAFLDIVNQKSGAQINVLPNT
EEQNMVNFLIQGSPEQILIAQCALEKLATDCEVITDVIDVPQTAFGRIIGRGGETLKFIN
RVSGAKVNCSKDRGRTLEENGKITITGTRKEIQSAKEMIMEKVIENETVRKRISQASALR
QRRKPPETQGPENELLKPNGKDLPTLVNELKQELPVTVNGYVDSTDTAENSLRSEDEEIL
SPVSPLEISKFEIPSPDLSFQPDEHLEVYVSASENPQHFWIQILGVRSLQLDKLTAEMSR
FYNGDSSQEHRVETIIVGDIVAAPYRDHGTWNRARVLGIVGSGLVDLYYVDFGDNGELPR
EHLRSMRSDFLSLPFQAIECSLAGVRPEGEVWTEAALDDFERMTFCAEWKPLLAKLYSYS
HSEISSWPSVKLYDNSQGKAVDLGKELIRLGHAVSCEDEGNGLRGDWDESRSLQKMLDDM
TGATSELSMSCISLSEVASISGSVDDTIDEEFN
Download sequence
Identical sequences F1R0M9
ENSDARP00000005097 NP_001014377.2.45394 7955.ENSDARP00000005097 ENSDARP00000005097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]