SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000009513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000009513
Domain Number 1 Region: 119-387
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-67
Family Nuclear receptor ligand-binding domain 0.00000876
Further Details:      
 
Domain Number 2 Region: 51-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-30
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000009513
Sequence length 402
Comment (Danio rerio)
Sequence
MAMVRGGWGDPNGETNGLGDKGYLRGDEDDGSPQGGGSDMEAGEDDKGCVVDCVVCGDKS
SGKHYGVFTCEGCKSFFKRSVRRNLNYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRK
EAVQRGRIPPSHSSLSPSTTPVGGNAGGGVSEFYNGQPVSELISQLLRAEPYPNSRYSHQ
YNQQMQGGGGGGSGMGIDSICELAARLLFSIIEWARNIPYFPELPVSEQVALLRLSWSEL
FILNAAQSALPLHMAPLLAAAGFHSSPMSAERVVSFMDQVRVFQDQVEKLTRLQVDSAEY
SCLKAIALFSPDACGLTDPAHVESLQEKAQVALTEYERMQYPGQPQRFGRLLLRLPALRA
VPASLISQLFFMRLVGKTPIETLIRDMQLSGSSISWPYAPGQ
Download sequence
Identical sequences Q6P117
NP_991120.1.45394 XP_005171281.1.45394 XP_021334608.1.45394 ENSDARP00000009513 7955.ENSDARP00000009513 ENSDARP00000009513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]