SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000009789 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000009789
Domain Number 1 Region: 103-168
Classification Level Classification E-value
Superfamily Chromo domain-like 2.23e-26
Family Chromo domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily Chromo domain-like 3.97e-22
Family Chromo domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000009789
Sequence length 174
Comment (Danio rerio)
Sequence
MGKKQAGKSKKEVQEIEEFVVEKVMDQRVVNGKVEFFLKWKGFTDADNTWEPEENLDCPE
LIAAFLESQKGVVEKPEAVKRKSSTDEPETEESKAKRKKEMSDKPRGFARNLEPERIIGA
TDSSGELMFLMKWKDSDEADLVPAREANTRCPQIVIAFYEERLTWHSCPEDEQQ
Download sequence
Identical sequences 7955.ENSDARP00000009789 ENSDARP00000009789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]