SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000030077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000030077
Domain Number 1 Region: 208-242
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000108
Family Tudor domain 0.022
Further Details:      
 
Domain Number 2 Region: 164-189
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000706
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000030077
Domain Number - Region: 426-492
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0188
Family Rabaptin-5 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000030077
Sequence length 504
Comment (Danio rerio)
Sequence
MDESSLEEAIGTYRAQLQQVELALSAGLGSAEQDDLLKLKEDLQQLIELTESSLVSVKKS
QLLAALEEASTNQSDTSVPQETALDNEFAAFYAELSEDSNEVKPNPDTDEENEEEEQDIS
GTKVCAPYRTSWGTLEYHNAMVVCPEEPEGEEARVRVFYIHPTHKSMKPCGFYLEGKCRF
MDNCRYSHGEVVCVSELRDFLEADISNMESGSACLAKHEDGIWYPARISEIEGGFYTVKF
DSLLLKEAVLEADGIIPPLRQDDVSSSSSSDSEDDAECDGGYAKVFTSREEDLAQVNTAE
FCGWEAHTRGIGSKLLMKMGYELGKGLGKTLSGRVEPVQAVVLPKGHSLDICAELTQRKT
AAAIAKNNPTSHKRKAKKKKASTSTRHNVFDFLNSKLGDRAQSASHSSSSLVTGAEAYRG
GKSTKRSLNVRLFEAAEKVTQVEREIQQLTKSLSKRNGRDAAVVSRLEEKLAASRKLLEQ
LKAQEQAIQREQKKADTHKKMTEF
Download sequence
Identical sequences Q7SXW2
7955.ENSDARP00000030077 ENSDARP00000030077 NP_956779.1.45394 ENSDARP00000030077 ENSDARP00000109806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]