SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000030883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000030883
Domain Number 1 Region: 638-693
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000249
Family Tudor domain 0.00026
Further Details:      
 
Domain Number 2 Region: 267-335
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000312
Family UBA domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000030883
Sequence length 734
Comment (Danio rerio)
Sequence
MCDLSSALIKEGWYLTDEGIEECKSSSEKEKTSPTDIIQVALNNDLRPIGKSFLPADINS
GRIEKLEGPCVLQVQKIRNVAASKDHEESQAAPRMLRVQMTDGHTACTGLEFKQLSKISL
NTPPGTKVKLLGVVQVKNGILLLDDSKIAVLGGEVDHMIEKWEFQRSLAKHSRRNIGAEG
GPPPFVPFGQKCVHKEQVDSRALDQRKTLQSTNAVKSADDNDEFEKQRTAAIAEVAKSKE
TRTFGGGGNAGGNLANPGSSFKSRDTYQRKREEREKPWTENKSDGVYRDLVDERALRDIM
EMGFNREAARQALLDNNNNLEVALNLLLTRANQPRAAPVEQSRPPPRGKGRGKGRSRQDE
DEEAGGRPSGPSTLFDFLESKMGTFSIDDSKPSQQDHQTKMNFSNSDQMSRDAGQFKPPP
RNDGRSQRNDRPPRFQKDGDFPKPTPASSSFSQPQKWRDGERTGRGGGPERWKNESQDAR
NAPLSYNSSFSKSREQQGASGKELNKEQDGTGPASFRKNQSNGPAPPKFSTPADPKMRNE
PNNRRKGRPERPNSGYFEHSQDALGKKDFQDEGQFVKVGPVSNTPLPNGDLEHRRTGPIK
PHFSAPPPRQTNMHNPASKRRSGPIKGPRDSVDINNFVNWKAGDQCLALYWEDNKFYRAR
IDAVHPSGSTAVVVFSDYGNCEEVLLDSIKPLHMDDDEDIYYENSLEFRRGGDGQPRRSR
PTQQYYQPPRARHT
Download sequence
Identical sequences 7955.ENSDARP00000030883 ENSDARP00000030883 ENSDARP00000030883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]