SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000038215 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000038215
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000391
Family Tudor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000038215
Domain Number - Region: 8-42
Classification Level Classification E-value
Superfamily TPR-like 0.0974
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000038215
Sequence length 237
Comment (Danio rerio)
Sequence
MSEELMKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTS
TKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNENGTAAITFAGYGNAEVMPLH
MLKKVEEGRIRDEIDGKPKSKKELQAEQREYKKKKAQKKVQRMKELEQEREDQKSKWQQF
NNKAYSKNKKGQVKRSIFASPESVNGKVGVGTCGIADKPMTQYNDTSKYNVRHLMPQ
Download sequence
Identical sequences B2GRC5 Q7ZV80
ENSDARP00000038215 7955.ENSDARP00000038215 NP_997766.1.45394 ENSDARP00000038215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]