SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000039217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000039217
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily PH domain-like 3.87e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000543
Further Details:      
 
Domain Number 2 Region: 225-333
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.92e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000415
Further Details:      
 
Domain Number 3 Region: 408-468
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000824
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000039217
Sequence length 479
Comment (Danio rerio)
Sequence
MSKGKSKGQENVSSSLLSSLENERLQELLGRRCVAMATAVVQLYMALPHSPTEWSLQHTG
VMCFVKDNPRRSYYIRLFDIMEAKVVWEQELYNQMTYSCPLRFFHTFAADDCQVGLNFAS
ETEADLFRNITEEKINQRTNRQEKRQHAPSEDKRPLPQIPPPNGPVSQPSVMATVDIQNP
DIVASRYRSTSVPTPAPACITTGKKDKKGKKKGPKLTKADIGAPSGFKHVTHIGWDPNSG
FDTNNLDPDLKKLFNIAGISDAQLADKETSKLIYDFIEQSGGLDAVKEEMRKQVPGGPRS
APAPPPPRGGLSSVPGPTGRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHKPP
PPPMGACAPPPPPPPPPPPSSSGNFSSSPVSSAPPPPPPSGGGGGGGGRGTLLEEIRRGR
VLKNVSESPDPNPPAQEESSEGIVGALMMVMQKRSKVIHSSEDEEDDGGEEEEDDEWDD
Download sequence
Identical sequences B0S5G8
ENSDARP00000039217 ENSDARP00000039217 7955.ENSDARP00000039217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]