SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000040264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000040264
Domain Number 1 Region: 177-286
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-16
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 
Domain Number 2 Region: 35-164
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000157
Family Ypt/Rab-GAP domain of gyp1p 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000040264
Sequence length 294
Comment (Danio rerio)
Sequence
MADDPQRNFRSAYYEKVGFRGVEEKKSLEILLKDNPLDVEKLSTFSQRFPLPSMYRIHVW
KVLLGILPPHSDSHALVRQYRVDQFEDVSCALTVMRFIHASTPQTEIYLRMFQLENHTLP
RRTELRPPDAEDENFLAIARAMEEIVDDPVDCFWLVRCFINQFKHKFGDSIPHLPKSLEH
FLSQEDVCLLSHLKASGALALLPYSLWFRRCFAGCLPESSLQRVWDKVISGSCKILVFVA
VEILLSHKIVIMGMNQPDAIYHFLSNMPQENTDAIVTKAIDLWHKYCGTPMHSV
Download sequence
Identical sequences F1QRX7
XP_021324055.1.45394 ENSDARP00000040264 7955.ENSDARP00000040264 ENSDARP00000040264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]