SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000042513 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000042513
Domain Number 1 Region: 218-520
Classification Level Classification E-value
Superfamily Kelch motif 7.06e-49
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 649-788
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-23
Family C-type lectin domain 0.0026
Further Details:      
 
Domain Number 3 Region: 2-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-19
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 4 Region: 925-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family Laminin-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000042513
Sequence length 1176
Comment (Danio rerio)
Sequence
FRLTEPSGYLTDGPINYKFKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIY
APLVAVFSGLIVPEVKGNETVPEVETNSGFALLHFFSDAAYNLTGFEIFYSINSCPNNCS
GHGKCSSGNSIASRVYCDCENFWKGEACDIPYCRNNCGSPDHGYCDFSGEKLCVCNDSWQ
GPDCSLTVPSTESYWIMSAMKPFGASLGRASHKAVVQEKVMWVVGGYTFNYSNFQMILNY
NLESGIWNTVPISSGPLPRYGHSLALYRDDIYMFGGKLEMGASNVTDELWVFNIPSMTWM
QKSPSVPAHGQVYAVEGHSAHLVEMDNGDVVMVVIFGYSSIYSYISNIQEYNIRTNTWLV
PETRGAIAQGGYGHSSVYDRGSKSVYVHGGYRSLPANKYGLVDDLYRYEVQTRTWTILRE
SGYPRYLHSSVLLGGTLLIFGGNTHNDTSLSNGAKCFSADFLAYDIACDEWKVLPKPNLH
RDANRFGHTAVTSNGSMYVFGGFSSVLLNDVLIYRPPSCEAFLGQDRCEAAGPGVRCIWK
RGRCVSWEPSFTNSATPAPFCPAKAATEDERCYRFSDCTSCTANTNGCQWCDSKKCISAL
SNCTSTVKNFTKCPIRNEQICSKMANCKSCSLNLSCQWDPQQQECHTLPAQLCGDGWSNV
GEVCLQINSSRESFDNAQHYCKNLEGKIASLTTAKQVDFVLEELQKHQQKEYVQSLKLSP
WVGLRKFNVSYWGWEDESPFTNTSLQWLPGEPNDSGFCAYLERAQVSGLRANPCTANTDG
LICEKPVVSPNQNARPCKTPCSLRTTCDNCTSQAMECMWCGSTKRCVDSNAYVISFPYGQ
CLEWQTADCLSQNCSGLRTCGLCLEQPDCGWCGDPSNTGRGQCMEGSYRGPMKSPSRHSQ
DMVLETGLCPKERGFEWAFIQCPACQCNGHSTCVNVSMCEQCRNLTTGLHCETCLPGYYG
DPTNGGKCQACKCNGHANMCHELTGKCFCTTKGIKGDQCQLCDSENRYLGNPLRGTCYYN
LLIDYQFTFSLLQEDDQHYTAINFMATPEQTSKNLDMSINASNNFNLNITWSVGSTAGTI
SGEEIPIVSKTNIKEYRDSFSCEKFSFHSNPNITFYVYVSNFSWPIKIQIAFSQHNSIMD
LVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRRE
Download sequence
Identical sequences 7955.ENSDARP00000042513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]