SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000047307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000047307
Domain Number 1 Region: 291-410
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1e-43
Family MBT repeat 0.0000373
Further Details:      
 
Domain Number 2 Region: 190-293
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.48e-41
Family MBT repeat 0.00000453
Further Details:      
 
Domain Number 3 Region: 401-530
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.6e-39
Family MBT repeat 0.0000173
Further Details:      
 
Domain Number 4 Region: 662-729
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000744
Family SAM (sterile alpha motif) domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000047307
Sequence length 739
Comment (Danio rerio)
Sequence
FRVNEFGVLEVITEEMEEERGKKAHATTTWSVPTAQEALSEGSVLKQDSPWGQRGLVCVR
CNRKGSAVDFLPDGLHCSERCLQQEQEELKTEGSRMNGELLSRKRTRLERSAEDMDSSMD
IPEEEDEDYEEKESRRPARGATRGRKKRRGDAALLRYTVPYGGKKKAWCWASYLEQERAI
AAPSKLFKECKNGFRVGMRLEGIDPEHPSMYCVLTIAEVSGHRIRLHFDHFSDCYDFWVN
SNSPDIHPVGWCEKTGHKLHPPKGVRDEEFSWSSYIKLNKIQTAPKALFHNQNMTVTPSG
FRVGMKLEAVCRKDPTFICVATVTDMVDSRFLVHFDNWEESYDYWCDATSPYIHPVGWCQ
ENGRTLSTPPGYPDANNFSWEKYLAETSSLPAPARAFKVKPPHGFQVNMKLEVVDKRNPV
LIRVATVADTDDHRLWIHFDGWTDEYDYWIDADSPDVHPAGWCAKTGHPLQPPITPQDMF
EASEQAGCPTAGCRGVGHIKGARYSGHHSAVGCPYSDINLNKDSVLPDRLSAETPGAGVG
RPRRAEANQEISADANDKPVTCVPLLPDKANTGVETPVKKPAGTETKRRVGRPCKVRKVE
VLPQEEEVESEVSSVTETKELTLQQALHQSVFMPCSSPSPSMPHCWDQHSKLLPTVAGIT
ASKVASWSIDEVIQFIQGLPGCKEQVRTFRDEQIDGEAFLLLTQVDLVKILSIKLGPALK
IYNSILMFKTTENSACNEL
Download sequence
Identical sequences ENSDARP00000047307 ENSDARP00000047307 7955.ENSDARP00000047307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]