SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000057262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000057262
Domain Number 1 Region: 57-203
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0086
Further Details:      
 
Domain Number 2 Region: 184-298
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000000000288
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000057262
Sequence length 399
Comment (Danio rerio)
Sequence
MKKAKKRLPASGSRASVGRHEENLPWKKKKLLDIHQALNSDPVDIETLRQAAVSEGGLLT
DDIRRKVWPKLLNINVYSLPAKPSKDVREDHKDYRQVVLDVRRSMRRFPKGMRVDEREVL
QEQLIDIILDVLRRNPQLHYYQGYHDIVVTFLLVLGERMTIAIMEKLSNHHLRDFMDPTM
DSTKHILNYLMPLLERVDRELHDFMIRSEVGTIFALSWLITWYGYVLSDFRHVLRLYDFF
LASHPLMAIYFAAVIVLYRQKEVKSSECDMASVHHLLSRMPQDLPYEDLIGRAQSLFSSC
PPSQMSRSAALQSRNILAISTFTDFQTSTRTQRPDSVLRQQIQNRQENQLALPMMPQPTG
TNQLIKMAVWGLSATLGAAALAVAQTALDWAPEFLSQLF
Download sequence
Identical sequences A0A0R4IYT6
7955.ENSDARP00000057262 ENSDARP00000057262 ENSDARP00000057262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]