SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000057624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000057624
Domain Number 1 Region: 32-271
Classification Level Classification E-value
Superfamily L domain-like 1.04e-42
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 437-739
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.68e-35
Family Rhodopsin-like 0.012
Further Details:      
 
Domain Number 3 Region: 298-367
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000374
Family Ngr ectodomain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000057624
Sequence length 800
Comment (Danio rerio)
Sequence
HHMVTLKNERLPINCVQELTAVSLHSNKNRRLDANLIMEVPARTLSGMRSLRHLWLDDNA
LTEIPVSALNDLSSLQAMTLALNRITLIPDYAFRNLSNLVVLHLHNNMIRTLGQNCFEGL
HSLETLELNFNDLQEFPVAIRTLAKLQELGFHNNNIKAIPERAFVGNPLLQTIHFYENPI
QFVGRSAFQFLPKLHTLSLNGATEIREFPDLKGTTSLQVLTLTRAGLTSLPYDLCHLLPK
LKVLELSHNVIEELPSFYHCTSLQEILDRGLQHNLIKQIEMNTFQQLVTSCFEPINKDLS
WNSINSIHPDAFFSLQSLIKLDLTGNRLSNLPMTGLTSLTHLKLKGNMALSRSFGLEDFP
NIRVIEMPYAYQCCVFGGCSSYRSASQWEEQMGSEEEDFQKKSPSLFPIHTDNNYDLDLE
EFQLAIEESKLQTSIQCTPIPGPFKPCDNLFDSWVVRLGMWLISLVSLMGNSLLILTVFT
SPSYLSPVKFIIGTISGANLLTGLCTGTLALVDARTFGEFALHGAQWEMGAGCRAVGFLS
VLASEGSILFLTLAAVQCSVSVSCARAYGKSPSLGSVRAAAVACLALSLAVAALPLIGVG
EYGATPLCMPSPLPDGEPSTLGFMVALIMMNSLCFLVITGTYIKLYWDLMKGDFDSIWDC
AMIKHVAWLIFTNCLLYCPVAFLTFSSLLSLFPVSEEVVKSVVLVLLPLPASINPLLYLL
FNPHFREDMRLLLSRAHLNHDRNLDSFVSVDTEKSSYDSTQALVSFATEADGVFESLSVP
NPETVARFTCPPSVALIPCQ
Download sequence
Identical sequences 7955.ENSDARP00000057624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]