SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000061105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000061105
Domain Number 1 Region: 126-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000126
Family Hairy Orange domain 0.0037
Further Details:      
 
Domain Number 2 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000061105
Sequence length 421
Comment (Danio rerio)
Sequence
MEERISRMQNRQFLDHADFLGVEYSSLYMCKSKRGMKREEGKDAYKLPHRLIEKKRRDRI
NECIGQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLNALTAVTEQQHQKIIALQNGERSL
KSSLQADLDAFHSGFQACAKEVLQYLNKVENWTAREQRCTRLINHLHKVSAQFQPGTGIL
QQPVAGDDAPERDTQRDPQANCVPVIQRTQNLELNENDTDTDSGYGGEAEKGDGKSEKGC
DTAKGVKIKQEFGDERVTKKAKMNWSANGGSDSTSTRPDVALMNSLMGMTGVGGQQTPFC
MPFYFINPSAAASYMPLFDKSHLEKLVYPAAAAAALTTPFPWLYPGIPTHASAAAAAAIA
FPNASTDKTSGFDAASSKDDEPESPDDDLSNEADLASPASEDHGSEIDTSHQPQRNDNDG
T
Download sequence
Identical sequences Q2PGD2
7955.ENSDARP00000061105 NP_001034196.1.45394 ENSDARP00000061105 ENSDARP00000061105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]