SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000062416 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000062416
Domain Number 1 Region: 112-126,264-514
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-66
Family Nuclear receptor ligand-binding domain 0.00000000532
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-30
Family Nuclear receptor 0.00014
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000062416
Domain Number - Region: 140-199
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.0399
Family TroA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000062416
Sequence length 516
Comment (Danio rerio)
Sequence
MLPKVESEYLGLARSHGEQGHMPGNMQAPQFKMMDYSYDEDLDEMCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCIENQSCQIDKTQRKRCPYCRFQKCLTVGMKLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMTQVMQTVPADLTITSAIQNIHSAS
KGLPLSHHHHHHHHHHHHSSSSAGLPPADFDRSPFVTSPVSMAMPPHAGGLQGYQAYGHF
QSRTIKSEYPTPTQARQSPHGLPLRRSLRGGSPPSFPHLVVELLKCEPDEPQVQAKILAY
LQQEQASRGKHEKLNTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSEL
LILDHVFRQVMHAKEGSILLVTGQQVDYALIASQAGATLNNLLSHAQELVSKLRSLQLDQ
REFVCLKFLVLFSLDVKNLENFHLVESVQEQVNAALLDYVMCNYPQQTDKFGQLLLRLPE
IRAISLQAEEYLYYKHLNGDVPCNNLLIEMLHAKRA
Download sequence
Identical sequences A0A0R4IW70
7955.ENSDARP00000062416 ENSDARP00000062416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]