SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000080361 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000080361
Domain Number 1 Region: 5-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.52e-69
Family BAR domain 0.001
Further Details:      
 
Domain Number 2 Region: 395-504
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.88e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.00022
Further Details:      
 
Domain Number 3 Region: 261-357
Classification Level Classification E-value
Superfamily PH domain-like 3.27e-24
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 520-599
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000293
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000080361
Sequence length 600
Comment (Danio rerio)
Sequence
MDTFLDFEDCIRDSPAFRQSLDKCESDMSELESRVEKVMKLCGQMVDAGQNYTSCNQLFL
CALSEFTAYHKSDGVILNCLRQFNQGLQEMIQFQTMLFDQTQRAISQQLTNLLSQFVPQI
RETRREFVRIGDDLDSAVVKNAQVSRHKPVDAERATHLLLATRKCYQHFALDYCLQLNNF
KVQQKLDILNSVFSYFHAQYTFFHQGFDLLRDLEPTMKTMASQLSQLSTDCSAKRKDLEN
THLLVQQRDASGEAVIVCNPSDGGTIQGYLFKRSRKKNKTWKRCWFSTENNQLIYLKSHK
EQPVVLFDDLRLCAVKSLDVIDRRFCFELLSVQKCCVLQADSEELKSAWMNAVQGCIDMA
YRDQVTDQNTQVKESSAPVSIPDPPSHPPALGVALSGRGNQHCCDCGEAEPRWASVNLGI
TMCIECSGIHRSLGVHLSKVRSLTLDSWEPEQLKLLCVLGNEVINGIYEREAADGLQKPS
AGSPRQDKEQWIRSKYVEKRFVARHLDGPDADALKLRARKRLYSASVSGDLVAMAESLAE
GAEINWNNNEQEGRTALIGSAIGGSLLACEFLLQNGANVNHRDQRGQGALHAAATYGHTG
Download sequence
Identical sequences F1Q975
ENSDARP00000080361 7955.ENSDARP00000080361 ENSDARP00000080361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]