SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000080972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000080972
Domain Number 1 Region: 225-413,478-520,613-678
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-51
Family Ankyrin repeat 0.00079
Further Details:      
 
Domain Number 2 Region: 762-1077
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.62e-50
Family Ankyrin repeat 0.0000618
Further Details:      
 
Domain Number 3 Region: 542-751
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.78e-34
Family Ankyrin repeat 0.00042
Further Details:      
 
Domain Number 4 Region: 51-162
Classification Level Classification E-value
Superfamily POZ domain 4.32e-19
Family BTB/POZ domain 0.0049
Further Details:      
 
Domain Number 5 Region: 1102-1161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000080972
Sequence length 1167
Comment (Danio rerio)
Sequence
MRTEEVQKLQKHLALLRQEYVKMQQKLVETERRCSVLAAQASVPGSSSQASDSFISRLLA
IVSDLYQQEQYSDLKVKIGDQRLSAHKFVLAARSEIWSLANLASTSELDLSDAKPEVAMA
MLRWTYTDDLELNGNDGFLIDLMKLANRFQLHLLRERCEKGVMSSVNVRNCIRFYQTAEE
LDAATLMNYCGEIIASHWDDLRKEDFSTMDAQLLYKMIKSKTEYPLHKAIKVEREDVVFL
YLIEMDAQLPGKLNELDNNGDLALDLALSKKLESIATTLVNNKADVDMVDQSGWSLLHKA
IQRGDEFASTFLIRHSAQVNAATVGAVETPLHLVCSFSPKKHSGEVMAGMARIAEALLKA
GANPNMQNSKGRTPLHEAVVSGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYITVAS
DPSVNPFEDEAPVVNGTSFDENSFAARLIQRGSNPDAPDTNGNCLMQRAAVAGSEAAAIF
LATHGAKVNHTNKWGETPLHTACRCGLAGLTVELLQQGANPNLQTDIALPGGVEKSQGVS
QQSPLHLAIVHNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSMDQTVLGLALWTGMH
TIAAQLLGSGAAINDTMSDGQTLLHMAIKRQDSKSALFLLEHQADINVRTQEGQTALQLA
ISNQLPLVVDAICTRGADMSVVNEKGDPPLWLALENGLEDIASTLVRHGCDATCWSSGPG
GCQQTLLHRAIDENNEVTACFLIRSGCDVNSSRRPGPNGEGDEEARDGQCPLHLAASWGL
EEVAQCLLEFGANVNAQDSEGRAPIHVAISNQQSVIIQLLISHPEIRLNIRDRQGMTPFA
CAMTHKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVQANVNSRVQ
DSAKLSPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLSTICSVLIENG
VDFAAVDENGNNALHLAVMQGRLNNVRALLTESNVDAEAYNLRGQSPMHVLGQYGKENAA
AIFELFLECMPEYPLDKPDNEGNTVLLLAYMKGNANLCRAIVRAGARLGVTNNQGINIFN
YQVATKQLLFRLLDMLSKEPPWCDGSNCYECITKFGVTTRKHHCRHCGRLLCHKCSIKEI
PIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences ENSDARP00000080972 ENSDARP00000080972 7955.ENSDARP00000080972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]