SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000090098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000090098
Domain Number 1 Region: 363-517
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-28
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1192-1304
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-24
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 
Domain Number 3 Region: 203-305
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 4 Region: 573-729
Classification Level Classification E-value
Superfamily Spectrin repeat 4.12e-18
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 18-91
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.005
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000090098
Domain Number - Region: 744-800
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00273
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000090098
Sequence length 1412
Comment (Danio rerio)
Sequence
ELPEADRMLTARDGARDEAQKLHRKWMKHQAFMAELARNKEWLAKIEQEGEELIQEQPEL
RSVVEMKLKEIRECWSHLENTTKVKARQLFETQNHRTTDLPTNNLSDLDQHLNIIQEQPP
TLGSTHTTQPTLLQPRPTFSQQLQRIQSWEDQMQLFHGVSEVMAGAEHRRPEGEEQGGVP
ETRIVRLIEPLKERRRILLASKELHQVTQDLEDEIIWIQERLHLASSIEYGTNLQSVQNL
MKNHEALQMEMQVRKGRLEEVLERAEAVAALRTPEVELVREGAGHVRQLWEVLQVEMERR
TVMLDAVNQAQQYYSQAAKTESWLSGQKLQVLNEEKGNDEASTLRLLKEQLALEQTVENY
AETVGSLSQQCRRMLELGHPDSEQITKQQAHIDRLYVSLKDLVEQRKTKLEQQYWLYQLK
REVEALEKWISEREAVASSTELGQDLEHVTVLQSSFTQFSSETRAVGQKQMDSVNKMVNE
MIDCSHSDAATIAEWKDGLNESWADLLELMETRAQMLAASYQLHKFFTDCQEIEGKMRQL
PEVRSCQVSSANPGTLQRLLHSFEHSLQLLVSQVRQLQENAVQLRAIYAGEKADAILSRE
QEVMQAWKELLVACEGSRVQVTTVTDKIQFFAVVRELSMWMDGIMGQIGPNDDARDLSVL
EGMMSQHQNLKSKMENKSKNFVHCVEMGKMLLAARNPAAEEVKEKLEYVMAKQKEMNERW
DLHWEKLQQAKQRLQSTQTGLTEQPWLTIKEPITPITREAGGGTDEVEELIRRHEAFRKA
ASTWKDHFSSLRQAEKMKEELNKPPSTSSLLSRQMFPLSCLVPSSSSSSSSSSLFRNPLQ
DSLLESKPGPDHMHSIEHTVTHTLPQRLGSSLNPYTPVMNGSSYHGLQQPSGVVNESPLY
QSIKQQGVSSLDNSSYQGLNQQVGVFGGNSSSYTGLNQQGALAEDGSSYHSLNHLGAVGV
VEPKIGYAWQHLKADCFQPKINHIHKAVSPLLEAHRAQLASAGANMPAPPVGMDPSLEMI
HSRLQRDPRGSRSDPQMDHLRREREYRLGRQTSSEQEIQARLNELPLIVRQERYRRRMER
QSSSEQEASGKQRVQKHDSSDAESGKEPSDKKPSGEKRSTMAEIVEQVQEREACHARGEV
YRPASSLSAPVSRLDRPRARDRPKPRRRPRPKEPEEPRRSRSAPAQSVPSTPQPPTHTVH
HEGFLYRKHEEEGKERSPNSKSWVNLFCVLKQGEIGFYKDARHTTTPYNDEPLLNLAICE
FDTTNGYKKKKNVFILRTTAEGDYIFLAKDEEDLKGWVNSINASLKEIEDIAKYEKATNS
STDPDKSERKERSEGAEPSEGVERSERSEKSERSDRSDKIEASDKSSERRDASEKERGDR
GERGERAERGDRERGERGDRGSRGSSTSGKSK
Download sequence
Identical sequences A2BGE8
ENSDARP00000120527 7955.ENSDARP00000090098 ENSDARP00000120527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]