SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000091041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000091041
Domain Number 1 Region: 195-428
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-84
Family SSRP1-like 0.00000575
Further Details:      
 
Domain Number 2 Region: 534-614
Classification Level Classification E-value
Superfamily HMG-box 1.44e-27
Family HMG-box 0.0000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000091041
Sequence length 681
Comment (Danio rerio)
Sequence
MSDTLEFNEIYQEVKGSWNDGRLRFSKQTVVYKNSKTGKVDTIPVPELTQAQWRRVCLGH
GIKLWTSTGHIYKYDGFKDADLEKISEYFKDNYKVELTEKDMCVKGWNWGTAKFNGPLLS
FDVNDSPTFEIPLSSVSQCTTGKNEVTVEFHQNDDTEVSLMEVRFYVPPTTGDEGSDPVE
AFAQNVLSKADVIQATGDAVCIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTV
LRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKEETISLTLNMNEDEVERRFE
GKLNKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGF
IYVHKPPVHLRFEEIACVNFARGTTTTRSFDFEIETKQGNQYTFSSIEREEYGKLFDFVN
AKKLSIKNRGFKEGMKGNDDMYSDSDEDQHDAYLERMKEEGKIREEGNDSDDSEGESDES
FNPGEEDEDIAEEYDSKASASESSAEEGDSDEDRKKKSAKKVKFVKERKPRKKEKKVKDS
GAPKRPMSAYMLWLNSSRDRIKSENPGISITEISKKAGEMWKQLGKDKKEEWDGKAEEAK
KEYDRAMREYRESGGGSSGSSKKERKKKRGRNEEKRKRKSGAGREKEKERSTGNDSFKSR
EFISSEESSSESDKGKKRKRK
Download sequence
Identical sequences 7955.ENSDARP00000091041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]