SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000091712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000091712
Domain Number 1 Region: 34-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 147-191
Classification Level Classification E-value
Superfamily LCCL domain 0.00000405
Family LCCL domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000091712
Sequence length 289
Comment (Danio rerio)
Sequence
MSGHTVLYGLILLYSIHPLVLAEKPDDGCGHYVLGQESGVLSSKNYPGTYPNNSWCEWRI
RVPIGHTIILKFGDLDMKKRDCESDYLKVLKGSYGSENVYWEYCGDPMPKPSQLHTDSNE
LTIRFRSSQHITGRGFLLSYSTENHKELLTCLDRGSHFTTAKYRKYCPAGCAALAGEVSG
DISLGYRHVSSGSLFSSGVSDKQRLILQENVSQACRVIYSFNMHPSRCSAGSFPNRFHMQ
SVSQQKKTASFVLLYGHLCAFLFLVLLVILAVNANIILLNSELLALLNY
Download sequence
Identical sequences A2BDL4
7955.ENSDARP00000091712 ENSDARP00000113311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]