SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000093542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000093542
Domain Number 1 Region: 153-239
Classification Level Classification E-value
Superfamily F-box domain 3.66e-17
Family F-box domain 0.0037
Further Details:      
 
Domain Number 2 Region: 62-97
Classification Level Classification E-value
Superfamily MIT domain 0.00000837
Family MIT domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000093542
Sequence length 421
Comment (Danio rerio)
Sequence
MAESNQNTDGAVEEGEDENTGDSNLQMELSAFRAKWMSELQPSSGGQRSFSRNAELRRRQ
ETAKEEKARELFLKAVEEEQNGAVYEAIKYYKSAMQLVPDIEFKINYSRTPDPERGGSYL
ESSENNREIDDLLTYFQHQLTLGNDAMKLCEHETETSQVHISALPFEVLMYIFRWVVSCD
LDLRALEQLSLVCRGFYICARDPEIWRSACLRVWGRSCTKMLPYSSWREMFLERPRVRFD
GVYISKTSYIRQGEESLDGFYRAWHQVEYYRYLRFFPDGQVMMLTTPEDPLVTVPRLRSK
NSRMDSIMFGHYRLSQDTDNQTKVYVVVSKRKEEKVSEYQRSRFCRRNPVPEAERSFHVG
LQLSSGGRQRFNKLVWIHHSCHITYRSTGETVVTAFDVDKMYTPLFFARVKSYTAFSERP
L
Download sequence
Identical sequences Q6P3K3
ENSDARP00000093542 ENSDARP00000093542 7955.ENSDARP00000093542 GO.79424 NP_956012.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]