SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000094721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000094721
Domain Number 1 Region: 425-637
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-43
Family DBL homology domain (DH-domain) 0.00073
Further Details:      
 
Domain Number 2 Region: 790-984
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-33
Family Pleckstrin-homology domain (PH domain) 0.00017
Further Details:      
 
Domain Number 3 Region: 626-742
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000094721
Sequence length 986
Comment (Danio rerio)
Sequence
DSEGENFISLDRKSIVTRSRSLSGKVPGYVPETVPEETGTEYQSHDYYTVALDQNGDPHP
KPSDEAEANRIIPSLKPRRFLLSPRSLSVEGRDLQLSGHFEGEKSLREEYRLQRKDDTLS
LPCVITSSGSFSQRSHQSSSGVSTPTSLVDIPPPFELAYITKRPVTKSSPSLLIQHDSPD
NPKKKKTSFKRFLALKFRKKSESKSRGDGSVRSSRSSSESSHHGPIRVLELDRRSTSGSP
KLQSHAGKPQRNSEIPTTFLLYKERQSRQGALKSYNSRGISRVESFEDRTRPPFMPLPLT
KPRSISFPSADTSDYENIPAMSSDYENIQIPHGRPTRAVTITEFFDDHNRTAAPANENDG
YVDMNSFAGIENKSTTREQDTESAYTEPFPVCPVSATVSNEEDHGRTSEEEDGCGDHCHD
RQIDGRSRAYYVAKDLVDSEREHVKALKVLQEDFRAAVESGGDDNGPLIENGKLDEIFST
LPQAYSLHSEILNELETRIKQWEDSPTVVDVILTRRAEFSSFATYISNYDRSMSVLDESC
RKSQAFEDVVKQFETQNAEGVLVPLKHQLLRVIVRILQYRMLLTDYLNNLSPDSKEYEDT
QAALVIVSEVADQVNDNLKHGENLLRLVHIDYSVRGKRDLLQPGRVFVKEGTLMKVSRKS
RQPRHLFLMNDVMLYTYPQQDGKYRLKNTLTLSGMKVSKPIIDNVLNTLRIEVSDVTITL
SASSLGEREDWFHTLSRAIADHAAGLNTFSSSSEAREKLWMSLGEAAPVLVPVSHVMMCM
NCTSDFSLTLRRHHCNACGKVVCRSCSRNRYPLKYLKDRMAKVCDHCYAELRKRGGDVPG
SCGSVSPRTHRASRPLSAVFQSLQPPSLWRNRKSSSPLTQVSVGAEGSTMSGSLQRRKKS
KRRWKRLWFLLKDKVLYTFKAREDKVASESLSLQGFTVKLSDRSEGEDTDNVFQLYHKKT
LYYTFRADDQPTARRWVNAMEEATVL
Download sequence
Identical sequences 7955.ENSDARP00000094721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]