SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000095561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000095561
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-80
Family F-box associated region, FBA 0.00000638
Further Details:      
 
Domain Number 2 Region: 32-108
Classification Level Classification E-value
Superfamily F-box domain 0.000000000113
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000095561
Sequence length 281
Comment (Danio rerio)
Sequence
MGQAESRNTDAPLTDVRSFESRSAEFSGVMPDVPLTVVEEILLNLPAHHVVNECRLVCPE
WKELVDSAAHWRERCMREGIQPCDASRPPVDWCQFYFITKKRRNLIKNPVADDEFQGWEI
VENGGDRWQVENNRRPLPDNTITQCFVTSYRLCLKRQLIDLQKEGYSAAFMDHLQPHIKI
SDWYGPRRDCGCEYQICVELLGHKKNRISVFQPEKVFIKAWNDEPWGHMIHVFKDYGPGV
RFIRFTHGGKDTQFWAGWYGIRVTNSSVEICPAAERESFPV
Download sequence
Identical sequences F1QLE3
ENSDARP00000095561 7955.ENSDARP00000095561 ENSDARP00000095561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]