SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000101038 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000101038
Domain Number 1 Region: 49-110,143-198
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 196-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000439
Family EGF-type module 0.0076
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000101038
Domain Number - Region: 237-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000101038
Sequence length 397
Comment (Danio rerio)
Sequence
MLGICLCLSVAVHFAVSQEAEAQEPVTYTASRPTFDEHDIYERELWELFDCLCTEGYEFD
FEKQICKDIDECKTVLEACKGGMKCINHFGGYLCLPHNARIIVSNGEGEPTTAPPVERFQ
PVIPQISRGEFSRVIQSSSHSIQCGVGFMADSQNYCRDVNECLTANPCQHQCYNLMGSYI
CQCEVGFELASDSVSCQDINECEISNYICQFQCVNEPGAFHCACPEGYQLQGPRMCQDID
ECETGAHNCREDEMCWNYYGGFRCYPRDPCREPYVKTGEGRCRCQSQTVCRGLPPVIVYK
YMSIFSDRSVPADIFQIQATSVYPNMVNTFTIKNGNEGGEFYLRRSSNVSAMLVMTKPLT
GPREHVVDLEMVTQSNVLSYRSSSLLRLTIVVGPYPF
Download sequence
Identical sequences A0A0R4IL08
NP_001103991.1.45394 ENSDARP00000101038 ENSDARP00000101038 7955.ENSDARP00000101038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]