SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000101878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000101878
Domain Number 1 Region: 50-213
Classification Level Classification E-value
Superfamily RUN domain-like 6.67e-30
Family RUN domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000101878
Sequence length 269
Comment (Danio rerio)
Sequence
ISAFTLLLLWCGKHLPPVRTLSDSKPQLNLHYLRIKMEIQEQEDGERRWELWKLLYNLKT
TVEGLLSTNNPNVWSRYGGLQRLHKDMNNILGHGLKHEQIYYKQKDYWRFVWCVRYLCPH
LARHVEQFSQLEPVLSSSVQSFGEGYKAERWLLHSLQAHVLSAQLKPLLQHKMNTQKYYN
DGAFLLSEPHVSAMFQCLEAVEQNNPRMLALIDTVRLSHLKESPLGLMKSQSLCLLPGAP
GHCRPADASQSHRLTTSQSCLTEISNSPQ
Download sequence
Identical sequences ENSDARP00000117514 7955.ENSDARP00000101878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]