SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000000031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000000031
Domain Number 1 Region: 1350-1414,1445-1624
Classification Level Classification E-value
Superfamily VPS9 domain 7.59e-39
Family VPS9 domain 0.0031
Further Details:      
 
Domain Number 2 Region: 16-220
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.49e-37
Family Regulator of chromosome condensation RCC1 0.0093
Further Details:      
 
Domain Number 3 Region: 511-668
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.83e-26
Family Regulator of chromosome condensation RCC1 0.054
Further Details:      
 
Domain Number 4 Region: 1021-1109
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.84e-25
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0031
Further Details:      
 
Domain Number 5 Region: 1115-1222
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.4e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0098
Further Details:      
 
Domain Number 6 Region: 911-993
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000385
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 7 Region: 676-876
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000523
Family DBL homology domain (DH-domain) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000000031
Sequence length 1627
Comment (Oryzias latipes)
Sequence
DGRKASFSEGDCGGERGLLHAWRGYSCSVTPERLLLPRPVLQVALGARHAVLLVEGGQVY
SLGALPWKQKASVATDPTPEGALSGQRVLAVAAGSFHCGAVTEDGGVHMWGDNGAGQCGL
SGLSSVPNPTPVALMEPESSSAQVVSVLELACGERHTLALSLQREVWAWGGGCQPCLNAA
ASPVWRPRKVEQLAGRRVLQVACGATHSLALVRCFGPGDTQRPPVDKCSQCNQLLYTMTD
KEDHVIISDGHCCPLGVEPTEDDPPTPALKTSPSEPVLTSHISASEPPGVTSSDSAHTED
SGKEGFLANEGEEPSSAVSRAKNSPYPDERAVKEYLRRLSDNTQADAKTATGGRQALLVT
LLQFCVFWLKLIPPSAGLASSTLNNLASCASAVGERVASTYEALSFKKMMNFYLPSRPPG
SEGGAEVGDLTADRVRQEDSVQTKKSCSTGDIHEEEAEGLRRRLSLPGLLSQVSPRLLRR
AGRSKVRAVALTPVVGAVPEAKEVLPSLQTEVWSWGSGEHGQLGHGDCSDQLQPLCIKSL
NNKEVVRVVAGAHHSLALTAQCQVFSWGRNHCGQLGHMEKPSTVPRLTKMSEGIRVWDAS
AGERHSLLLADGDCIQPIIYYSGQQMPTLQNNAKVNSKSVCILFVFQLGYVSNVCAGGGR
CMALSDRNVMGLIASLHELASTERKFYCKLCNIKSQVIRPLLELESLSSALGQTTIGVLQ
TLAGQFGGLCHLTGQHSASLTSNLRRCRGLQGLLILNHHDIFLDSYSDYCSAVGNFQVMG
GFQSLAKPLLDAFGKSPELLQRLSECSEENAAVPDLMVALFYLPFHHVQEYGRLLLKLAT
CFEVNSEDYRKLQDSCSKFEALSLQLKRRRKEAEYTFHFWKSFPGKMTDSLRKPQRRLIC
ESSNKTLTLQNAGRFSVNWFILFNDALVHAQFSSHHIFPLATLWVEPIPEDDSSLHGLKV
ITPEETLTLLASSPSEKSKWLRAINQAVDQALSGTAQKSEPPISRTAAYTFYKEGRLKEA
TYEGGWVSGKPHGSGVLKWPDGRIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDG
KMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFD
DITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGVLVSEDDTTYEGDFSD
DWTLSGKGVLTLANGDYLEGSFSGEWGSGLKVTGSYFKPHLFDSGKDKTRAVKLGRLCVS
AEEKWQAVFQECWSQLGCEAPERGEHLKAWENIAVALTSHRQHIRDSPGLLSRSHSKTLE
GLEVVPQHEGPITMERYDLIRVYLLNACDTPLHPLGQLVETLVAVYRMTYVGVGANRRLL
PLAVTEIKSYLSRIFQIVRFLFPDLPEEGVQIPEPASNIQMKREPSAADAPLESPRPGLV
VSSWTLLLPVLLPRLYPPLFTLYALEKEKEDDVYWECVLRLNKQPDLALLAFLGVQQKFW
PISPSIPETGVSVVSTTKDACFASAVETLQQISTTFTPTDKLQVIQLTFEEITQVVQSLL
KQDFLWSMDELFPVFLYVVLRARIRNLGSEVSLMEDLMDPSVQHGELGIMFTTLKACYYQ
IQHEKIT
Download sequence
Identical sequences H2L2T4
ENSORLP00000000031 ENSORLP00000000031 8090.ENSORLP00000000031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]