SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000000517 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000000517
Domain Number 1 Region: 148-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 92-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 54-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000000517
Sequence length 309
Comment (Oryzias latipes)
Sequence
QGEPEPQQIKEEQEGLCITQDGQDEEGSQREVSTTKDEETDTQNRDQRKRRDKRSYICEE
CGKSFGCWSQFKIHMRTHTGEKPFSCKVCDTSFSHKSNLNTHMRTHTGERPFPCKICEKS
FSQISSLNAHTRIHTGEKPFSCKVCYTSFSNASHLKTHTRKHTGEKPFSCKECDTSFSHK
SNLNTHMRTHTGERPFPCKICEKSFSQISSLNAHTRIHTGEKPFSCKVCYTSFSNASHLK
THTRKHTGEKPFSCKECDKSFTQKYNLKTHMRTHTGEKPFSCKECDKRFSQIVNLKKHMR
THTREKPFS
Download sequence
Identical sequences H2L436
ENSORLP00000000517 ENSORLP00000000517 8090.ENSORLP00000000517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]