SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000000780 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000000780
Domain Number 1 Region: 133-272
Classification Level Classification E-value
Superfamily ISP domain 3.45e-38
Family Rieske iron-sulfur protein (ISP) 0.00000173
Further Details:      
 
Domain Number 2 Region: 78-146
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 4.8e-25
Family ISP transmembrane anchor 0.0000743
Further Details:      
 
Domain Number 3 Region: 1-56
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 8.17e-20
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000000780
Sequence length 273
Comment (Oryzias latipes)
Sequence
MMSLAARSGAFSPYLQATAFTVAGPLKALVPGVVLKTDKVLLDTKKPFLCRESLRGQSPL
TGPAVTVSINGRAGVRFAHTDIKVPDFSDYRRPEVLDPHKPSTESSESRRAFSYLLTGAT
AVVSVYAAKTVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTE
KEISAEEAVSLAELRDPQEDKDRVIKPKWVIVIGVCTHLGCVPISNAGDYGGYYCPCHGS
HYDASGRIRKGPAPLNLEVPYYEFPDDDTVVVG
Download sequence
Identical sequences H2L4T0
ENSORLP00000000780 XP_004066864.1.28442 8090.ENSORLP00000000780 ENSORLP00000000780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]