SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000001270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000001270
Domain Number 1 Region: 104-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-19
Family Classic zinc finger, C2H2 0.00039
Further Details:      
 
Domain Number 2 Region: 806-873
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000231
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 3 Region: 73-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000327
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 4 Region: 590-648
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000684
Family Homeodomain 0.0062
Further Details:      
 
Domain Number 5 Region: 723-776
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000984
Family Homeodomain 0.00035
Further Details:      
 
Domain Number 6 Region: 298-348
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000355
Family Homeodomain 0.012
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000001270
Domain Number - Region: 880-922
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000171
Family Homeodomain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000001270
Sequence length 924
Comment (Oryzias latipes)
Sequence
MSSRRKSTTPCMVPPREAMESDLESEDIMDESDPEGRNGLEAFSSEVPVLMEDQDEDFRQ
DVVSDPYLDLNTAEGGYECKYCSFQTSELNQFTMHVDAEHPDVVLNTSYVCMECDYHTKS
YDTLLAHNARFHPGEDNFTRTMVKRNNETVFQQTVNDLTFDGSFIKDEEDEQEDTSRKAI
PLSKTPIMRIRSRAEPKKFAATPPALSPAPMNLSAAVTPRLVPVTTPLQLQAVPQSIVVN
APNMLQIKGGSGGGGAVLPPETLAQVLSALQNQHNSSQTQLLIPISSIPTYNTAMDNNVL
LIGAYNRFPYPSVSEITGLSSQTKFSEEQIKVWFSAQRLKHGVSWTPEEKKMDIQRHKYM
FCTVLVSYKDIYHLKASEQRTKFVLIVGRMRHLVIGAESQRDSEFRTDWRLLSSVLVSRI
KRQEFMRDSPLSSKKRLKNRRQKPDFPRSGSLTLSSLGRFPHFCCLQWEINSSTDFPSNL
QVEEARRKKFNGTVQSVPQTITVIPANIAAASNGLQSIFQTCQIVGQPGLVLTQVAGNSS
GVPVASPVTLTVAGVPGKQPKAAEPSASEASTEMLASPNSGALGVDASGSKPKKSKEQLA
ELKASYSRRQFATEAEISRLMQVTKLSKRAIKKWFSDTRYNQRNSKEHHSLLLGEPLPGR
AGAGRGGRGSSHGENVGGDHTATIVIDSSDDASDASPTSNNAQGSSGSTSSPRAKFRNAL
PDFTPQKFKEKTPEQLLVLEASFQSSDRPSDEELSRLRAETKLTRREVDAWFTERRKLPL
LSEKLRAGRTPPSSAHEQQSAPPLSRKAIKKTPEQINVLKRAFVRTQWPTPEEYDKMAEE
SGLPRSYIVTWFGDARYACKNNNLKWYYLYQSGKVPTAVFVKSGKEFLKDYYLKHRALSE
KDLDDLVTKSSMSYEQVRDWFSQT
Download sequence
Identical sequences H2L626
ENSORLP00000001270 ENSORLP00000001270 8090.ENSORLP00000001270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]