SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000002815 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000002815
Domain Number 1 Region: 86-134
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 48-83
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000229
Family Somatomedin B domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000002815
Sequence length 173
Comment (Oryzias latipes)
Sequence
METRGWSSVHFGFVVCGYLAFFCAEFFPVAEAGCRERMSPNCCSGRNNDCYESSRRKTVC
YCDTYCQKTGDCCEDYRGVCQISVAIDCVVGSWGAWSLCTSKCGVGSTERSRQVSVPPRN
GGAPCPDLRQRRGCYGNAAVCSAAKEVAKILPDSFKRNFKDPWRRPHMMIKEE
Download sequence
Identical sequences H2LAA8
ENSORLP00000002815 8090.ENSORLP00000002815 ENSORLP00000002815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]