SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000004353 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000004353
Domain Number 1 Region: 219-519
Classification Level Classification E-value
Superfamily Kelch motif 9.02e-50
Family Kelch motif 0.0024
Further Details:      
 
Domain Number 2 Region: 612-782
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-25
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 3 Region: 3-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-19
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 930-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family Laminin-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000004353
Sequence length 1139
Comment (Oryzias latipes)
Sequence
RLTDLSGSLTDGPVNYKYKTKCTWLIEGYPNTELRLRFNHFATECSWDHMYVYDGDSIYA
PLIAVFSGLVVPETRRNETIPEVMTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSG
HGRCSAANSMAGRVYCECEEYWKGEACDIPYCKHNCGSPDHGYCDLTGEKLCVCNDSWQG
PDCTLTVPSTEAFWVLPSIKPSTQSLGRASHRALVHSGLMWVVGGYSFNYSNYHMVLNYN
LDSSTWDAVPAGDGPLNRYGHSLALYKDDIYMFGGKLEAGTYNITDEMWVFNIPGRTWSP
RKPAPPPPYAVEGHTAHVVELSDGEPTMLVFFGYSPIYSYINKVQEYNIRSNSWQVASTS
GAVVQGGYGHTSVYDETSGCVYVHGGYKALSSNKYGLVDHMYRYHIAKKTWLVLRESGLA
RYLHSAVLLSGTMLVFGGNTHNDTSLSNGAKCFSADFLAYDIACDTWTTLPRPGLPRDAN
RFGHSAVVSNGSMYIFGGFSGVLLNDVLAYTPPSCRAFISPAACFVARPGIRCLWVNSRC
VPWESKEPLQSVPAPYCPARPDSSDEECFRFSDCASCTSNTRGCQWCEDRKCISASSNCT
VLQVSIKMIKCFYFGMLANCRSCSLNINCQWEPQQQECQALPGQLCGEGWQHVGEACLKI
NSSRESYDNAQHYCKNMGGNIASLLTDNQVNFVLEELQKYQLQDKSMSELSLSPWVGLRK
INVSYWGWEDASPFTNSSLRWLPGEPSDSGFCAYLERAQMASLKANPCTATTDGLICEKP
AGRPQNLSARPCKTPCALRTSCANCTSQAMECMWCGSTQRCVDSSAYVISFPYGQCLEWQ
TQDCSALNCSGLRTCADCLQRAECGWCSDPSNTGRGVCMEGSYRGPLKPANPRSRSRDRV
RLRDGDMVVDQSLCSTDKGYNWAFIQCPACQCNGHSKCVNGTVCELCGNLTAGSQCQSCM
PGYYGDPTNGGKCHVCKCNSHANVCQASTGKCFCTTKGVKGDQCQLCDSENRYLGNPLRG
TCYYNLLIDYQFTFSLLQEDDRYYTAINFMATPEQANKNLDMSINASNNFNLNITWSLSS
TAGTISGEEMPIIVRTNIKEHKDSFSCEKFNFKLHHNITFFVYVSNFSWPIKIQVRGTS
Download sequence
Identical sequences H2LEI1
ENSORLP00000004353 8090.ENSORLP00000004353 ENSORLP00000004353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]