SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000005468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000005468
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-70
Family Eukaryotic proteases 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000005468
Sequence length 261
Comment (Oryzias latipes)
Sequence
TDLATMHDLMLLSFLLCLGTKAAAADGSEIVNGIEVPDGKMPYMVSVQNATDHICGGFLY
NEEFVITAAHCDSEKARVSHVVLGSNNLNNINKTMRIKIKKCKHEDYTKTASGHDIMLLQ
LTKKVKLSNKVEQIKLPKSGTNVSANTKCTVAGWGKTETRGKVMKKLRMVEVSVIDLNQC
KRVWKKSNGNFPNNIVCAGGYKVKQGFCQGDSGGPLVCDETAVGIVSFNSNHDCDYPKLP
NVYTDVSKYIDWIKKTVKQKK
Download sequence
Identical sequences H2LHK5
ENSORLP00000005468 ENSORLP00000005468 8090.ENSORLP00000005468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]