SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000005597 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000005597
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-63
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000005597
Sequence length 224
Comment (Oryzias latipes)
Sequence
MAVSQEQSVCLGLWMVLLLGAGMEEAVEGCSCHPSHPQQLFCSAEIVIRAKISGEKIVSP
SNSSSPYMKMIQYEIKMIKMFKGFDRAKDIQYVYTPVFSSLCGVKLDSNNKAGYLLSGSM
WNDGRVSIGQCDLVESWDNLSLSQKKNLNYRYQLGCECRINTCYTVPCASTGENECLWTD
WLLDNSLNGEQARQYACVRRSDMSCSWYRGGPQPDKDFLDMTDP
Download sequence
Identical sequences H2LHY0
XP_004068700.1.28442 ENSORLP00000005597 8090.ENSORLP00000005597 ENSORLP00000005597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]