SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000005736 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000005736
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily POZ domain 4.32e-30
Family BTB/POZ domain 0.0000138
Further Details:      
 
Domain Number 2 Region: 513-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 554-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 457-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000317
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000005736
Sequence length 634
Comment (Oryzias latipes)
Sequence
MALTADGCIQFTRHAGDVLLNFNRLRSRNMLTDVTVQVDGQDFHAHKTILVACSGFFYSV
FMHPENANLSAISLDPKVDPECFSLLLDFMYTSCLNLNDSLVLATLNTAVYLQMEHVADT
CHRFIKSRHQSLNMQLDGEGSVSMSLPEEIPAARQTKEQDADSRAKSPSSTSSLQDGRAY
IPTVFRGINTSSSYHVYGDSYIPAGKFSDSHEIGPQNPEFSTVLDRSALPHCAFSSAVIK
PALGHGSTQAPTAAMEEDGPQHPPASYLRLSSSYNRGVICSPQSPLRSDCQPNSPTESSS
SISASMSQNQAQHCPKEAKARNWKKYKFIVLNQTTDGSDKEAQGSSTDVRVESPAHSPSR
SGAAGGPGEHMEEGATEQRDDSGSSRNAAQTEKAVTRAKNSSPHRSSTYGCDSPRSVEGS
RLSPDSYSREDNAKPHSAYSPSSCDNDYFSSGCDSKFAEEEHLKEHMLQAHSDKPYRCDC
CQAAFRYKGNLASHKTVHTGAKPYHCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGSR
FVQVAHLRAHVLIHTGEKPYPCEICGTHFRHLQTLKSHMRIHTGEKPYHCEKCDLHFRHK
SQLRLHLRQKHGAVTNTKAPYRRPSSNAAAIGSC
Download sequence
Identical sequences H2LIB4
ENSORLP00000005736 ENSORLP00000005736 8090.ENSORLP00000005736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]