SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000006071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000006071
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 1.41e-28
Family BTB/POZ domain 0.00078
Further Details:      
 
Domain Number 2 Region: 459-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 438-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000117
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000006071
Domain Number - Region: 394-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000217
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000006071
Sequence length 549
Comment (Oryzias latipes)
Sequence
AAAGYEDGRMEFPDHSRHLLQCLSEQRHQGFLCDSTVLVGDAQFRAHRAVLASCSMYFHL
FYKDQLDKRDVVHLNSDIVTAPAFSLLLEFMYEGKLQFQDLPVEDVLAAASYLHMYDIVK
VCKKRLKQKATAEADSTRREEDGGSSCSDKADSLSDGSTGRPATADLLHSDEEEEVKAVG
GPLWLRLPPGERPRTPAMATTSPGHGEAETQPAGSPSSSTGSLSQRSHRSVNSRIGHRGR
RVSNDAADCVLDLSVKPIASSNHSTHHQSYFSGAATPDSLQSPLAVRVKVERGVASDEEE
ELGGGDYDMEHSGLTKTSLSNANGAQRRLGLEAHLSALREASLASELERDEKPAAPADDE
DLLGGENERAQAEVASMDNSLLPYVSNMLSAQHTQIFMCPLCNKVFPSPHILQLHLSSHF
REQEGIRSKPAGDVNVPTCTICSKTFSCMYTLKRHERTHSGEKPYTCTTCGKSFQYSHNL
SRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKSEPLALPNVRDWAI
EDSSQELWK
Download sequence
Identical sequences H2LJ85
ENSORLP00000006071 ENSORLP00000006071 8090.ENSORLP00000006071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]