SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000007240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000007240
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 1.22e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000007240
Sequence length 101
Comment (Oryzias latipes)
Sequence
VRLVNGDNKCSGRVEVLRHEQWGTVCDHGWDVQEASVVCFELGCGLAESASRGAEFGPGS
GEIVLHHVQCSGHESSLTRCAVVLHSNSYCTHENDAGVRCS
Download sequence
Identical sequences H2LMG9
8090.ENSORLP00000007240 ENSORLP00000007240 ENSORLP00000007240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]