SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000008003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000008003
Domain Number 1 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-17
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 2 Region: 383-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000455
Family Classic zinc finger, C2H2 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000008003
Sequence length 476
Comment (Oryzias latipes)
Sequence
MLNNMDLNSKDSFHPQFENCSSSSLMENTARKDNQEVYVDGERGVPAQFGHEGAPAALKT
EASNSEFAFNPCECPKDTYTPSSLAYSGSFYVEASQGAPCSTETLLNMITEIVGISTLPL
SEVHQSGNSRGTYPSPAPLESGDDSFGDSGVKRQPYTCSGPNPPVYSPDQNCRRYTDDQP
SSQVPDPSTSLLSFGSPRAPNPKKTEPKSEAATFPVVVKNEFESSCYEWGAFSKSECLES
TFQGETFPMSSDFPPDQQVDVKDLLDTFHPICANPEMEFKVEGGIKQEPCFSDTCSQSYS
SPLYNNYLPPPPVGLSNMKPFPEPPQPSNQCDSLYISPAIPSTIDSLLYSSLMPDSFAQS
YNNRPTKPPRARKSPAASHGPAKEKPFTCPMESCDRRFSRSDELNRHIRIHTGHKPFQCR
ICLRSFSRSDHLTTHTRTHTGEKPFSCDVCGKRFARSDERKRHGRVHLKQKEKMEI
Download sequence
Identical sequences H2LPL9
ENSORLP00000008003 8090.ENSORLP00000008003 ENSORLP00000008003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]