SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000009354 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000009354
Domain Number 1 Region: 387-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.51e-29
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 86-238,382-465
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.35e-17
Family HI0933 N-terminal domain-like 0.08
Further Details:      
 
Domain Number 3 Region: 978-1010
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000419
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000009354
Domain Number - Region: 1011-1039
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0689
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000009354
Sequence length 1039
Comment (Oryzias latipes)
Sequence
KTMGKPEEENVAKLFENFIQASTCKGALQAFNVLCRRLDLDPADHDTFYSSLKAKVSCWK
ANALWSKLDKRMSHKEYKKGQACVNTKCLIIGGGPCGLRTAIEFALMGAKVVVLEKRDSF
SRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIQQLQLILLKVALIVAVEFHINV
EFVKLLEPPEDQTNEGVGWRAAIRPADHPVANFDFDVVVGADGRKNSLDGFKRKVLRGKL
AIAITANFVNSNTTAEARVEEISGVAFIFNQKFFLDLKAKTGVDLENIVYYKDNTHYFVM
TAKKQSLLEKGVLINDYVETEMLLSSQNVNQEALLSYATEAANFGTHYQLPTLKFAENHC
GQPDVAMFDFTNMYASENAALIRERHGHQLLVALVGDSLLEPFWPMGTGCARGFLSGFDT
AWMVRSWAEGRSVLEVLAERESIYRLLPQTTPENIAKNFDLYTIDPSSRYTNLNSTCVRP
NQVHHLYITGELNHCSLERAVTIRRPINQKKDCEIRPSRLLTWCKKQTEGYRNVSIKDLT
SSWKSGIALCALIHRFKPQLIDFDSLNEEDHRANLQLALDISEQEFGIQPFTSAKEQSTN
EELDKSRVIAFLSKFYELFRGSPLPALAETRKLDENKECYPSKEIRCNDDAFSFSPHRKR
IPKDEKKTESTNFINKRRRTFCIEEVTNLGYNTYVQDKQNSKDNKVGTLSTQLLAKFEIN
SSSSVPKTQDCRKVKRLCLPLVLCKDPVGPQESLPVKIRPPVPPKPPSVTQFEISIRKAA
EQLVSPKTLPEPRLHPHRPFTDLKLRHVDQAFTEMKPQPENPELPAPVPSLHSGICFMRR
ILHRLREVEEHVSEKRAQTQKVREFHSKSIKEKAVHLRGLFSEHKCKGVTPCFRLIPSDL
KNRRPTGDTRCWKLLQPHAISTRRAFNHLQPSNSRRVILWWYMEGFFAPPRLLAPTHLPH
AGTAPTRSYEGTSVRRAFSQSSEKCHSCKKRVYMIERVRAEGLCFHRECFRCSICSSPLP
QGLHVFNPDNEKLYCRPHF
Download sequence
Identical sequences H2LTD6
ENSORLP00000009354 ENSORLP00000009354 8090.ENSORLP00000009354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]