SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000009470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000009470
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 1.83e-16
Family Hairy Orange domain 0.0022
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000051
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000009470
Sequence length 279
Comment (Oryzias latipes)
Sequence
MPADMMEKNSSSPVAATPASMNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALNTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMNYPSQHQHQHPLPSTAGPTHPSFSQPM
VQIPSSSPQILPMNPASCKGGSSPAALPSDATKVYGGFQIVPATDGQFAFLIPNAAFAPN
GPVIPVYANNVSTPVSVPAAVSPGAPSGTTDSVWRPWKN
Download sequence
Identical sequences H2LTQ0
8090.ENSORLP00000009470 ENSORLP00000009470 ENSORLP00000009470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]