SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000010031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000010031
Domain Number 1 Region: 78-125
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000010031
Domain Number - Region: 39-80
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00222
Family Somatomedin B domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000010031
Sequence length 263
Comment (Oryzias latipes)
Sequence
MVGSSAGLACWLLLAITVGQNSLVTGGCSGKCCWGRDLSCYTSDWRMDRSYGTCYCDESC
VKTKDCCFDYFTECPARDCVVSNWSPWSGCAKPCQLSVRSRVRHVKQKPSNGGEPCPRLE
ERAGCKEYRDHRGSRCGRNSDPAFITSMQFGKGRPKRDSYGNPLDPGFCMELKLESRTPP
CTAENRPHTLWMRYIAEGFKVCVTCEPPASQNRSLCQGDGQDSDKQAVLHWQAAGNPRCY
GTWRKIQRMQQCDCPPQHTFVFI
Download sequence
Identical sequences H2LVA1
ENSORLP00000010031 ENSORLP00000010031 8090.ENSORLP00000010031 XP_004081071.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]