SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000010471 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000010471
Domain Number 1 Region: 848-1119
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000396
Further Details:      
 
Domain Number 2 Region: 1114-1416
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.22e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000145
Further Details:      
 
Domain Number 3 Region: 2-120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-29
Family MAM domain 0.0000383
Further Details:      
 
Domain Number 4 Region: 322-526
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-26
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 5 Region: 218-353
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000722
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000010471
Domain Number - Region: 121-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00013
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000010471
Sequence length 1417
Comment (Oryzias latipes)
Sequence
PSGSFMMVNSSQHFGGQRAQLHLLPLSENDTHCIQFSYFLYSRDGHSPGALHVYVRVNGG
PKGSAVWNASGSQGRQWHQVELAVSTFWPSEYQIIFEATVSEERDGYMALDDIILLTYPC
YKVPHFSRLGDVEVNAGQNASFQCVATGKVSETEPFLLERRSGVLLDTSLLSRLSHKRLM
ATFQVEAQRGEQDLYRCITQSTRGAAVSNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLN
TNSIVGDGPVIRREIQYRATQSMWTETHGVGSLTYKVWHLEPDTEYRISVLLTRPGEGGT
GAPGPPLISRTKCAEPMRALRGLTATEIQPRQLALQWEPLGYNLTRCHTYSLSLCYRYSM
PTGGSGGNNATVRECLSLDRNTSHFTLRDLPPFRAVHVRLALANPEGKKESREVTFQTEE
DIPGGIAPDSLTFTPLDDMIFLKWEEPVEPNGLITQYEISYQSIESSDPSINVPGPRRTV
SKLRNETYHMFSGLHPGTTYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPSPLSE
SENTITVLLRPAVGRGAPVSSAYQVVVVEEDGSRQVRRRELGTVDCFPTPNSHSEAQAKG
APHYYTAELAPSSLPEATPFTVGDNHTYNGYWNSPLDPTKNYLIYFQAASNFRGETRINC
VRIARKGIIVRNQVTAWYQQSSIRIGTAKFSILGPPLPVPSLHKHAEDMGLILGACAGGL
VVLILLLGAIVFILKKGRKKVAINKAAMSYRQEKSRKLSSVDCSMTEQSTLQQDERMAHS
FMDAHGCNARINQPSPSGRRRSAKTSAFVFPDEQRSSVNESSSLLGGSPQRQCRRKSSPY
HTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFDGWDVTKKKDKTKGRHDSLLSHD
RHRVKLHSLLADPSSDYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVWQENCFSIVM
LTKLVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVCQF
HFTSWPEHGVPYHATGLLAFLRRVKTSTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAE
CEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAIPVAEFAPTYKEMLK
VDSQSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDRSLAFLVTTE
GESSNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLNQLNQSNSAW
PCLQYWPEPGLQQFGPMTVELLSRTADDDVIIRLFRIQNITRLHEGQLLVRHFQFLRWSP
YRDVPDSKKTFLSLLAQVHNWQRECGEGRTVVHCLNGGGRSGTFCACTMILEMIRHHSVV
DVFFAAKTLRNFKPNMVETVEQYRFCYELAQEYLNCL
Download sequence
Identical sequences H2LWI3
ENSORLP00000010471 8090.ENSORLP00000010471 ENSORLP00000010471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]