SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000010484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000010484
Domain Number 1 Region: 699-896
Classification Level Classification E-value
Superfamily Sec7 domain 7.46e-73
Family Sec7 domain 0.00000209
Further Details:      
 
Domain Number 2 Region: 456-636,749-768,1150-1162,1196-1544
Classification Level Classification E-value
Superfamily ARM repeat 1.7e-28
Family PHAT domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000010484
Sequence length 1855
Comment (Oryzias latipes)
Sequence
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKQESEKLSRRSPPSGD
GKSGSSTLPPIKSKTNFIEADKYFLPFELACQSKCPRIVITSLDCLQKLIAYGHLTGSAP
DNTAPGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRT
CYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLERERHRQHSPNTPQTEP
DSPQLQTHAHPPAKALTQEANGPISPPTPSINIPSTPNPDPENGSEFCATENEQTEADQA
TAAAQSAAAQQTEGAEEAEAMPNYEEKAQEIVQSILQEVVNTVAGGENEGEAAEATEAGP
EGTQSSLDDEVTLGSDSEHVHANGIPGTPISASFTPSLPDDRLSVSSTDTQESGAAPGQP
AGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSILQNAGPI
FKTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIEVFFKEI
FLYILETSTSSYDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIA
QGRGGHELGITPQQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQES
TETKAPETINRYGSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFN
KKPKRGIQYLQDQGMLGTTPEDLAQFLHQEERLDSAQTQVGEFLGDNDRFNKEVMYAYVD
QMDFQGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLA
YSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAMKETK
ELTMKSNKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFK
LAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLT
ASSGIAEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKARYIS
GTVRGKDGFLSSIKEQSSDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRIFTGS
TRLDGNAIVDFVRWLCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIG
DHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTI
RDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEKH
FAATIDSFQDAVKCLSEFACNASFPDTSMEAIRLIRHCAKYVSERPQAFKDYTSDDMNVA
PEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLFRIVF
RIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYFESLNNILLDDILAQLYWCVQQD
NEQLARSGTNCLENVVILNGEKFSLETWDKTCNCMLDIFKTTIPHMLLTWRPAGAEGEHY
ATHSLSDRQLDSVSQKSVDIQSRPDDQHSISSADRISTENRRQSQHATPPTKIQEQRLFS
ALLIKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDAVCEADVSAEMQDQGMYRYL
TSEQLFKLLDCLLESHRFAKAFNSNNEQRTLLWKAGFKGKSKPNLLKQETSSLACGMRIL
FRMYTDESRQDAWEEVQRRLLNVCSEALAYFLALTSESHREAWTNLLLLFLTKVLKISDE
RFKAHASRYYPLLCEIMQFDLIPELRTVLRKFYLRIGVAFHIAQLPEPEPQPSRE
Download sequence
Identical sequences H2LWJ4
ENSORLP00000010484 8090.ENSORLP00000010484 ENSORLP00000010484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]