SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000014478 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000014478
Domain Number 1 Region: 854-938
Classification Level Classification E-value
Superfamily DEATH domain 2.46e-22
Family DEATH domain, DD 0.0000313
Further Details:      
 
Domain Number 2 Region: 156-247
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 244-298
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 4 Region: 300-354
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000719
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 5 Region: 49-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000862
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000014478
Sequence length 944
Comment (Oryzias latipes)
Sequence
AWQRRNARRVTSEINEQKCFVIPLSESSDDVDTEGLPDSYPSAPAEPLPVFLLEPEDAFI
VKNRPVQLRCRASPATQIYFKCNGEWVNQNDHVTRESLDQITGLVVREVDISVSRTQVEE
LFGLEDYWCQCVAWSSAGTTKSVRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEG
MPAAEVDWLKNEDVIDPSKDSNFLITIDHNLIIKQARLSDTANYTCVARNVVAKRRSSTA
TVIVYVSGGWSSWTEWSECNARCGRGWQRRTRSCTNPTPLNGGAFCDGPPVQRVTCTTLC
PVDGGWTEWAKWSACGTECTHWRSRECQAPSPINGGKHCSGSMMESKNCTEGLCARNKKI
SIEHSSHPLAPGMGEAVYAGLVVALLLSVVMVLCVGVLAYRRRCRHLHGDITDSSSALTT
AFHPGNYKPPRQDNPRPLHPPAPPDLTATAGTFRGPLFSLQQAVHDSPHKIPMTNSPLLD
PLPSLKIKVYNSSTLSSLELPADSGDGEILSLKSVGMVSKEREYHSHTLSREPGLSTSAT
LGNLGGRLTIPSTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTSPSEGSQTVLSPVVSCG
PSGMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGGWEEVLTVGEETLSSPCYVQLE
EESCHVLLEQLGTYGLVGQSCPPQPACKRLQLALFAPRAPCLSLDLSLRIYCIHDTPHAL
KEVMDLERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWS
GSQRPLHCTFSLERSSLAVSQLTCKICVRQVEGEGQIFQLLTDIQEVTLCPVGIMEKLRK
GGSCLPSSQVGPYAFRLPDSIRQKICTSLDAPSARGCDWRLLARSLGFDRYLNYFATKPS
PTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTDGDC
Download sequence
Identical sequences H2M7M0
8090.ENSORLP00000014478 ENSORLP00000014478 ENSORLP00000014478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]