SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015274
Domain Number 1 Region: 39-242
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-52
Family DBL homology domain (DH-domain) 0.00000168
Further Details:      
 
Domain Number 2 Region: 229-391
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-31
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 3 Region: 508-609,657-683
Classification Level Classification E-value
Superfamily SH2 domain 1.97e-26
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 4 Region: 422-491
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 5 Region: 615-671
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000296
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015274
Sequence length 689
Comment (Oryzias latipes)
Sequence
EHDLGEDDIYDCVPCEDDGDDIYEDIIKVEVRQPMKMGMTEEDKRHCCLVEIQETEAKYY
KTLEDIEKNYMIPLKQVLSQLEMEKIFVNLEDIIRVHFGLLRAIDLTMVSGGSGLGKIFI
DFKERLLIYGQYCSHMENAQKTLDDLTATREDIKIKVEECTLKVQEGKFKLQDLLVVPMQ
RVLKYHLLLKELLSHSTDRPERQQLKEALEAMQDLAMYINEVKRDNETLKKISEFQSSIE
NLQVKLEEYGRPKIDGELKVSSIINRTKQDRYIFLFDKVVIVCKRKGYNYELKEIIELQS
YKMSDDLMNNRDMKKWSYGFYLIHLQGKQGFQFFCKAEDTKRIWMEQFEMAMSNIKPERA
TANQHNFQMHTFDKNTNCRACKKLLRGIFYQGYYCTRCGTGAHKECLEVVTICKFSDPHD
LTALICFPGPKMVAVRNYHGTSPPLGKTPLCFQTGEIIELLKGDPDTTWWEGRLIQTQKS
GFFPSSCVKPCLDPKSISYRQSSRESDYYGYPWFAGNMERQQADNLLKSHSSGTYLIRER
TAEAERFAISIKFNDEVKHIKVIEKDSWIHITEAKKFESLLELVEYYQSHSLKESFKLLD
TTLRYPYKSRERSLTRASTRSPVFTPRVVSTAVARYNFAARDMRELSLREGDIVKIYSKI
GGDQGWWKGEANGRIGWFPSTYVDEEGVQ
Download sequence
Identical sequences H2M9T2
ENSORLP00000015274 ENSORLP00000015274 8090.ENSORLP00000015274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]