SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015402
Domain Number 1 Region: 2-338
Classification Level Classification E-value
Superfamily L domain-like 1.02e-65
Family Internalin LRR domain 0.054
Further Details:      
 
Domain Number 2 Region: 832-927
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-27
Family PDZ domain 0.0034
Further Details:      
 
Domain Number 3 Region: 680-789
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-27
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 4 Region: 559-654
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-24
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 5 Region: 929-1026
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-24
Family PDZ domain 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015402
Sequence length 1074
Comment (Oryzias latipes)
Sequence
PFFRLLNLRRLGLSDNLLQKLPPDVSNFMQLVELDISRNEISEIPESIKFCRALEIADFS
GNHLSRLPDGFTQLRALAHLTLNDVSLQTLPSDIGNLANLVTLELRENLLKSLPTSLSFL
VKLEQLDLGNNELEVLPDTLGALPNLRELWLDRNQLSSLPPELGNLRRLVCLDVSENRLE
ELPSEVSGLLALTDLLLTQNMLEALPDSIGSLKQLSILKVDQNRLTHLTDSVGECENLTE
LVLTENFLQSLPSSLGKLKKLTNLNVDRNRLGSVPAELGGCASLNVLSLRDNRLDRLPAE
LADATELHVLDVAGNRLQNLPFALTNLNLKAMWLAENQSQPMLKFQTEDDERTGEKVLTC
YLLPQQPSSSLENLQQNSVDDSWTDSNLNRVSVIQFQEETKAEEEEDEEAAAERRGLLRR
ATPHPSQLKVMKKGMEDRRNEAYTPKTDEEESLDPQPTVHFAEEPIIRGGEEDDEDEGEN
GERSDEEDERPVYVAEKQRLIRKDTPHYKKHFKITKLPKPEAVAALLQGFNPDSLHPPPQ
PAGVSFDQVNNLLIEPARIEEEEELQHTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFI
SRVSEEGPAARAGVKVGDKLLEVNGVDLHEAEHHTAVEALRSSGATVSMTVLRERMVEPE
NAITTTPLRPEDDYFPRERRSSGLGFSVDASPPGQRQCFSTCLIRNDKGLGFSIAGGKGS
TPYRTGDMGIYISRIAEGGAAHRDSTLRVGDRVISINGVDMTEARHDQAVALLTGTSPTI
TLLVERDPNAPAGSPGQNRARSHSPPPPEPSDSPDQEEDGFQGNHSGRMEDEYPIEEVTL
VKSGGPLGLSIVGGSDHASHPFGINEPGVFISKVIPHGLACQSGLRVGDRILEVNSTDLR
HATHQEAVRALLANKQEIRMLVRRDPSPPGMEEIFIQKQPGEKLGISIRGGAKGHAGNPF
DPTDEGIFISKVSSTGAAARDGRLQVGMRILEVNNHSLLGMTHTEAVRVLRAVGDSLVVL
VCDGFDPRKVAAVEASPGIIANPFATGIVRKNSIESISSIDRELSPEEMDILQK
Download sequence
Identical sequences H2MA54
8090.ENSORLP00000015402 ENSORLP00000015402 ENSORLP00000015402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]